| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330617.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| PITNHFHNSPAVRRRASSAVPLCCSLQTGGRRSGGYKPALWDFDSIQSLKTTNCEDERNLTKRVDLIGQVKKMLVEVGVNDVARLELIDELYRLGISWHFEDEIIQILNSSHRSGVDPTD LYSTSLGFRLLRQYGVPVSQEVFDCFKNDNGTNFKPSLGNDIKGLLQLYEASFLQTQGEETLELAKEFATNLLYKTLEGTDHEIDNNLLSSIKSALEFPTHWRVQMPNARSYI | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 26,366.416 | ||
| Theoretical pI: | 5.717 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
| Instability index: | 43.873 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.401 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.249 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330617.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| PITNHFHNSPAVRRRASSAVPLCCSLQTGGRRSGGYKPALWDFDSIQSLKTTNCEDERNLTKRVDLIGQVKKMLVEVGVNDVARLELIDELYRLGISWHFEDEIIQILNSSHRSGVDPTD LYSTSLGFRLLRQYGVPVSQEVFDCFKNDNGTNFKPSLGNDIKGLLQLYEASFLQTQGEETLELAKEFATNLLYKTLEGTDHEIDNNLLSSIKSALEFPTHWRVQMPNARSYI | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 26,366.416 | ||
| Theoretical pI: | 5.717 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27180 | ||
| Instability index: | 43.873 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.401 | ||
Secondary Structure Fraction | |||
| Helix | 0.318 | ||
| turn | 0.249 | ||
| sheet | 0.245 | ||