Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330623.1 | 5prime_partial | 133 | 606-205(-) |
Amino Acid sequence : | |||
LGFRSLAVFCFLLLVIGKNPSFRPQFVQEIVFFINRSICVHTRARIGGSHAAHSLPPPPRRRRIAAEHAEGMRGGFGRAGGGAAAVCDSGDVRQPSAVHAAAQGVGGGVRIRSERSDQYP LPCGGVLPCSLPD* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 12,499.069 | ||
Theoretical pI: | 7.009 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 56.415 | ||
aromaticity | 0.083 | ||
GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.193 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330623.1 | complete | 117 | 153-506(+) |
Amino Acid sequence : | |||
MVVVTLVVVMVELRRLLINQATNMAKLLHMAGDIDRTFLIESVLLLRRLEQLREQRMVDVHHRNHKPLLLRPLPYQNRHASLRRAPPRSAAAVVVVEVNVRHVIHRFARAYVHRSID* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 12,499.069 | ||
Theoretical pI: | 7.009 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 56.415 | ||
aromaticity | 0.083 | ||
GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.193 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330623.1 | complete | 109 | 458-129(-) |
Amino Acid sequence : | |||
MPHIHFHHHHGGGGSRRSTPKGCVAVLVGQGAEQQRFVIPVMYVNHPLFTQLLKASEEEYGFDQKGPINIPCHVEEFCHVRCLIDKEAAELHHHHHQSHHHHQFLCFKA* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,499.069 | ||
Theoretical pI: | 7.009 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
Instability index: | 56.415 | ||
aromaticity | 0.083 | ||
GRAVY | -0.483 | ||
Secondary Structure Fraction | |||
Helix | 0.266 | ||
turn | 0.193 | ||
sheet | 0.211 |