| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330631.1 | internal | 262 | 3-788(+) |
Amino Acid sequence : | |||
| VFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDYNYG DFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIGDEISAVLGKQSVT ESNLHQLPYFAGTINEKLRAHS | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 18,827.557 | ||
| Theoretical pI: | 6.117 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 45.863 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.180 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330631.1 | 3prime_partial | 167 | 503-3(-) |
Amino Acid sequence : | |||
| MLFAVFSHDFPSLLDIIIVEKCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHL LLPHPAVVVHHLVGEKWEGHYAPHLAPVLPVHREHHVLPVAREYVEH | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,827.557 | ||
| Theoretical pI: | 6.117 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 45.863 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.180 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330631.1 | internal | 262 | 3-788(+) |
Amino Acid sequence : | |||
| VFDIFTGNGQDMVFTVYGEHWRKMRRIMTLPFFTNKVVNHYSRMWEEEMDLVVQDLRNDVRVREEGLVVRRRLQLMLYNIMYRMMFDAKFESQSDPLFVQATKFNSERSRLAQSFDYNYG DFIPLLRPFLKGYLAKCRDLQSRRLAFFNNYYVEKRRKIMAENGEKHKISCAIDHIIDAQMKGEISEANVLYIVENINVAAIETTLWSMEWAIAELANHPTIQQKIGDEISAVLGKQSVT ESNLHQLPYFAGTINEKLRAHS | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 18,827.557 | ||
| Theoretical pI: | 6.117 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 45.863 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.180 | ||
| sheet | 0.293 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330631.1 | 3prime_partial | 167 | 503-3(-) |
Amino Acid sequence : | |||
| MLFAVFSHDFPSLLDIIIVEKCEPSALQVSAFSKVALQERPEQGDEIAVVVIKALRQSAALRVELGGLDKQRITLRLEFGIKHHSVHDIIEHELKPPPNNQPFLSDPHVIAQVLDDKVHL LLPHPAVVVHHLVGEKWEGHYAPHLAPVLPVHREHHVLPVAREYVEH | |||
Physicochemical properties | |||
| Number of amino acids: | 167 | ||
| Molecular weight: | 18,827.557 | ||
| Theoretical pI: | 6.117 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 45.863 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.365 | ||
| turn | 0.180 | ||
| sheet | 0.293 | ||