| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330641.1 | internal | 212 | 1-636(+) |
Amino Acid sequence : | |||
| GVSMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIAMAAYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAIEILKLMSSTFLVGLCQAIDL RHLEENLKISVKNSVSHVAKKILTTSQNTMLHPSRFCLKELLEVVDREHIFTYIDDPCSFNYPLMQKLRQVLVNHALANVEAEKELATSIFL | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 12,620.480 | ||
| Theoretical pI: | 6.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33375 | ||
| Instability index: | 49.873 | ||
| aromaticity | 0.127 | ||
| GRAVY | 0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.227 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330641.1 | complete | 110 | 509-177(-) |
Amino Acid sequence : | |||
| MCSLSTTSSNSLRQNLDGWSIVFCDVVRIFLATWLTEFLTEILRFSSRCLKSMAWHSPTKKVEDMSFKISIASAVFLEEMRPNEFTSWLCCSALCTWFVTGLAKNWSSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,620.480 | ||
| Theoretical pI: | 6.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33375 | ||
| Instability index: | 49.873 | ||
| aromaticity | 0.127 | ||
| GRAVY | 0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.227 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330641.1 | internal | 212 | 1-636(+) |
Amino Acid sequence : | |||
| GVSMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRDPSLDYGFKGAEIAMAAYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTAEAIEILKLMSSTFLVGLCQAIDL RHLEENLKISVKNSVSHVAKKILTTSQNTMLHPSRFCLKELLEVVDREHIFTYIDDPCSFNYPLMQKLRQVLVNHALANVEAEKELATSIFL | |||
Physicochemical properties | |||
| Number of amino acids: | 212 | ||
| Molecular weight: | 12,620.480 | ||
| Theoretical pI: | 6.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33375 | ||
| Instability index: | 49.873 | ||
| aromaticity | 0.127 | ||
| GRAVY | 0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.227 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330641.1 | complete | 110 | 509-177(-) |
Amino Acid sequence : | |||
| MCSLSTTSSNSLRQNLDGWSIVFCDVVRIFLATWLTEFLTEILRFSSRCLKSMAWHSPTKKVEDMSFKISIASAVFLEEMRPNEFTSWLCCSALCTWFVTGLAKNWSSEQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,620.480 | ||
| Theoretical pI: | 6.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33000 33375 | ||
| Instability index: | 49.873 | ||
| aromaticity | 0.127 | ||
| GRAVY | 0.169 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.227 | ||
| sheet | 0.264 | ||