| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330642.1 | 5prime_partial | 204 | 742-128(-) |
Amino Acid sequence : | |||
| STFLVGLCQPIDLRHLEENLKISVKNSVSHVAKKILTTSQNTMLHPSRFCLKELLEVVDREHIFTYIDDPCSFNYPLMQKLRQVLVNHALANVEAEKELATSIFLKIGEFEEELKALLPK EVEKVRAEFETKKASIDNRIKNCRSYPLYRFVREVAGTDFLTGEKARSPGEEFDKVFTAICEGKLIDPLLDCLKEWNGAPLPIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 13,264.844 | ||
| Theoretical pI: | 10.658 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 54.152 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.100 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.369 | ||
| sheet | 0.221 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330642.1 | complete | 122 | 114-482(+) |
Amino Acid sequence : | |||
| MIIFHQHIGRGAPFHSLRQSNNGSINFPSQIAVNTLSNSSPGERAFSPVKKSVPATSLTNLYKGYDLQFLILLSMEAFLVSNSARTFSTSLGRRAFNSSSNSPIFKKMEVANSFSASTFA NA* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,264.844 | ||
| Theoretical pI: | 10.658 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 54.152 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.100 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.369 | ||
| sheet | 0.221 | ||