Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330645.1 | 3prime_partial | 224 | 2-673(+) |
Amino Acid sequence : | |||
MDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNP HDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVA | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 13,152.111 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 95.204 | ||
aromaticity | 0.009 | ||
GRAVY | -1.583 | ||
Secondary Structure Fraction | |||
Helix | 0.156 | ||
turn | 0.248 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330645.1 | 5prime_partial | 183 | 3-554(+) |
Amino Acid sequence : | |||
WIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTP TTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 13,152.111 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 95.204 | ||
aromaticity | 0.009 | ||
GRAVY | -1.583 | ||
Secondary Structure Fraction | |||
Helix | 0.156 | ||
turn | 0.248 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330645.1 | 5prime_partial | 140 | 673-251(-) |
Amino Acid sequence : | |||
SNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAA VRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 13,152.111 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 95.204 | ||
aromaticity | 0.009 | ||
GRAVY | -1.583 | ||
Secondary Structure Fraction | |||
Helix | 0.156 | ||
turn | 0.248 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330645.1 | 5prime_partial | 109 | 1-330(+) |
Amino Acid sequence : | |||
YGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 13,152.111 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 95.204 | ||
aromaticity | 0.009 | ||
GRAVY | -1.583 | ||
Secondary Structure Fraction | |||
Helix | 0.156 | ||
turn | 0.248 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330645.1 | 3prime_partial | 224 | 2-673(+) |
Amino Acid sequence : | |||
MDPVSQWGNAPLSVVDPDIHDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLTRSRALQAYRLDPTKWGVNVQPYSGSPANFAAYTAVLNP HDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESFPYKVDSKTGYIDYDRLEEKAMDFRPKLIICGGSAYPRDWDYKRFRQVADKCGALLLCDMAHISGLVA | |||
Physicochemical properties | |||
Number of amino acids: | 224 | ||
Molecular weight: | 13,152.111 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 95.204 | ||
aromaticity | 0.009 | ||
GRAVY | -1.583 | ||
Secondary Structure Fraction | |||
Helix | 0.156 | ||
turn | 0.248 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330645.1 | 5prime_partial | 183 | 3-554(+) |
Amino Acid sequence : | |||
WIPSHNGATLLSPSSTPTSTTSSRRRNAASAAGSSSSPPRTSPPSPSSKPSEARSPTNTPRACPATATTAATSSSTRSRTSLAHVPSRPTASTPPNGASMSSLTAAPPLISPPTRLFSTP TTGSWASICLPAAISRTVTTLPAGRRSVPPRSTSRAFRTRLIPRRGTLITIGWRRRPWISGPS* | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 13,152.111 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 95.204 | ||
aromaticity | 0.009 | ||
GRAVY | -1.583 | ||
Secondary Structure Fraction | |||
Helix | 0.156 | ||
turn | 0.248 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330645.1 | 5prime_partial | 140 | 673-251(-) |
Amino Acid sequence : | |||
SNEATNMRHIAEQKRPALISNLPKSLVIPVPRISTPSTNDQLGPEIHGLLLQPIVINVPRLGINLVRKALEVDRGGTDLLPAGSVVTVREMAAGRQIEAHDPVVGVENSRVGGEISGGAA VRLDIDAPFGGVEAVGLEGT* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 13,152.111 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 95.204 | ||
aromaticity | 0.009 | ||
GRAVY | -1.583 | ||
Secondary Structure Fraction | |||
Helix | 0.156 | ||
turn | 0.248 | ||
sheet | 0.211 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330645.1 | 5prime_partial | 109 | 1-330(+) |
Amino Acid sequence : | |||
YGSRLTMGQRSSLRRRPRHPRPHREGETPPVPRDRAHRLRELHLLRRHRSPRKRAHQQILRGHARQPLLRRQRVHRRDREPHSLTCPPGLPPRPHQMGRQCPALQRLPR* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 13,152.111 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 95.204 | ||
aromaticity | 0.009 | ||
GRAVY | -1.583 | ||
Secondary Structure Fraction | |||
Helix | 0.156 | ||
turn | 0.248 | ||
sheet | 0.211 |