| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330661.1 | internal | 262 | 3-788(+) |
Amino Acid sequence : | |||
| WMSNANQSIPHAAVAAASPGLVQAPSSAAFLKHPRTPGPGMDYQTADSEHLMKRLRTGQPDEVSFSASTQPPNLCSPDDLPKTVIRNLSQGSNVMSMDFHPQQQTVLLVGTNVGDISIWE VGSRERLALKTFKVWDISACSMPFQTTLVKDATISVNRCVWGPDGSILGVAFSKHIVQIYTYNPAGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKTIKVWDAVAGRRHYIFEG HEAPVYSVCPHYKENIQFIFST | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 28,739.278 | ||
| Theoretical pI: | 6.419 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36815 | ||
| Instability index: | 42.528 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.260 | ||
| sheet | 0.202 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330661.1 | internal | 262 | 3-788(+) |
Amino Acid sequence : | |||
| WMSNANQSIPHAAVAAASPGLVQAPSSAAFLKHPRTPGPGMDYQTADSEHLMKRLRTGQPDEVSFSASTQPPNLCSPDDLPKTVIRNLSQGSNVMSMDFHPQQQTVLLVGTNVGDISIWE VGSRERLALKTFKVWDISACSMPFQTTLVKDATISVNRCVWGPDGSILGVAFSKHIVQIYTYNPAGELRQHLEIDAHVGGVNDIAFAHPNKQLCIVTCGDDKTIKVWDAVAGRRHYIFEG HEAPVYSVCPHYKENIQFIFST | |||
Physicochemical properties | |||
| Number of amino acids: | 262 | ||
| Molecular weight: | 28,739.278 | ||
| Theoretical pI: | 6.419 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36815 | ||
| Instability index: | 42.528 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.196 | ||
Secondary Structure Fraction | |||
| Helix | 0.286 | ||
| turn | 0.260 | ||
| sheet | 0.202 | ||