| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330662.1 | 5prime_partial | 222 | 698-30(-) |
Amino Acid sequence : | |||
| FTKVVQSWDISAANELPLYMRICYEALLGVYEEMRERIGVQYAIETMKELVESYMTEAEWCHTNCVPTTDEYMKVALISAGYLMVIANFLVGTEENSVTKNDFDWIMNRPPIVQASELLA RLMDDIAGHGKEEKVTAISCYMKEHGCSEMEATRELSKQVKKAWKDLNAEWMEPRSASVEILACVVNVTRVLHILYSTGEDGFSDSSTRTTQFIKSLLVDPY* | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 25,279.699 | ||
| Theoretical pI: | 4.782 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42775 | ||
| Instability index: | 37.632 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.176 | ||
| sheet | 0.315 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330662.1 | 5prime_partial | 222 | 698-30(-) |
Amino Acid sequence : | |||
| FTKVVQSWDISAANELPLYMRICYEALLGVYEEMRERIGVQYAIETMKELVESYMTEAEWCHTNCVPTTDEYMKVALISAGYLMVIANFLVGTEENSVTKNDFDWIMNRPPIVQASELLA RLMDDIAGHGKEEKVTAISCYMKEHGCSEMEATRELSKQVKKAWKDLNAEWMEPRSASVEILACVVNVTRVLHILYSTGEDGFSDSSTRTTQFIKSLLVDPY* | |||
Physicochemical properties | |||
| Number of amino acids: | 222 | ||
| Molecular weight: | 25,279.699 | ||
| Theoretical pI: | 4.782 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42775 | ||
| Instability index: | 37.632 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.141 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.176 | ||
| sheet | 0.315 | ||