| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330671.1 | internal | 255 | 3-767(+) |
Amino Acid sequence : | |||
| IFSLKLGFRRCVVVSSPTLVEECFATNDVVLANRPPILVDKYIGYNNTSMPGAPYGEHLRSLRRIAAQEVLSTSRLNAFLQIRQDEVNRLLLNLLKGSDSEVKLRPILSQLTFSNMMRML AGERYSFEEDEESVEGRRFRKLINNVFEIAQASNPQDFLPFLQRIDYGGFQKKLGSLKDEMDEMLQSLVDEHRQEKRNSMIGHLLSLQQSEPQFYSDLTIKGLVMSLVFAGTDTSAITME WAMSLLLNHPHILEK | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 20,228.609 | ||
| Theoretical pI: | 11.803 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 106.567 | ||
| aromaticity | 0.045 | ||
| GRAVY | -1.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.181 | ||
| turn | 0.277 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330671.1 | 5prime_partial | 177 | 2-535(+) |
Amino Acid sequence : | |||
| HLLPQTRLPPLRRRVLPNSSGGMLRHKRRRLGQSTSHPRRQVHRLQQHLHARRSLRRTPPQSPPHRRPGGALHFPPQRLPTNSARRSESPAPQPPQRIRFRGEIEADIISTHLQQHDEDA CRGKIFLRGRRGERGGAQIPEADQQCFRDCAGIQSAGFPAFSAADRLWRFSEETGES* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 20,228.609 | ||
| Theoretical pI: | 11.803 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 106.567 | ||
| aromaticity | 0.045 | ||
| GRAVY | -1.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.181 | ||
| turn | 0.277 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330671.1 | internal | 255 | 3-767(+) |
Amino Acid sequence : | |||
| IFSLKLGFRRCVVVSSPTLVEECFATNDVVLANRPPILVDKYIGYNNTSMPGAPYGEHLRSLRRIAAQEVLSTSRLNAFLQIRQDEVNRLLLNLLKGSDSEVKLRPILSQLTFSNMMRML AGERYSFEEDEESVEGRRFRKLINNVFEIAQASNPQDFLPFLQRIDYGGFQKKLGSLKDEMDEMLQSLVDEHRQEKRNSMIGHLLSLQQSEPQFYSDLTIKGLVMSLVFAGTDTSAITME WAMSLLLNHPHILEK | |||
Physicochemical properties | |||
| Number of amino acids: | 255 | ||
| Molecular weight: | 20,228.609 | ||
| Theoretical pI: | 11.803 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 106.567 | ||
| aromaticity | 0.045 | ||
| GRAVY | -1.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.181 | ||
| turn | 0.277 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330671.1 | 5prime_partial | 177 | 2-535(+) |
Amino Acid sequence : | |||
| HLLPQTRLPPLRRRVLPNSSGGMLRHKRRRLGQSTSHPRRQVHRLQQHLHARRSLRRTPPQSPPHRRPGGALHFPPQRLPTNSARRSESPAPQPPQRIRFRGEIEADIISTHLQQHDEDA CRGKIFLRGRRGERGGAQIPEADQQCFRDCAGIQSAGFPAFSAADRLWRFSEETGES* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 20,228.609 | ||
| Theoretical pI: | 11.803 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 106.567 | ||
| aromaticity | 0.045 | ||
| GRAVY | -1.098 | ||
Secondary Structure Fraction | |||
| Helix | 0.181 | ||
| turn | 0.277 | ||
| sheet | 0.215 | ||