Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330677.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
VEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRTGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEEDPLFVKLKALNGERSR LAQSFEYNYGDFIPILRPFLRGYLKMCQQVKDRRLQLFKDYFVDERKKLVSTKPADKDGLKCAIDHMIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKL | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 27,947.925 | ||
Theoretical pI: | 8.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35535 | ||
Instability index: | 45.420 | ||
aromaticity | 0.114 | ||
GRAVY | -0.439 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.165 | ||
sheet | 0.249 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330677.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
VEFGSRTRNVVFDIFTGKGQDMVFTVYGEHWRKMRRIMTVPFFTNKVVQQYRTGWEAEAAAVVDDVKKNPESATNGIVLRRRLQLMMYNNMYRIMFDRRFESEEDPLFVKLKALNGERSR LAQSFEYNYGDFIPILRPFLRGYLKMCQQVKDRRLQLFKDYFVDERKKLVSTKPADKDGLKCAIDHMIEAQQKGEINEDNVLYIVENINVAAIETTLWSIEWGIAELVNHPEIQKKL | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 27,947.925 | ||
Theoretical pI: | 8.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35535 | ||
Instability index: | 45.420 | ||
aromaticity | 0.114 | ||
GRAVY | -0.439 | ||
Secondary Structure Fraction | |||
Helix | 0.338 | ||
turn | 0.165 | ||
sheet | 0.249 |