Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330685.1 | complete | 241 | 95-820(+) |
Amino Acid sequence : | |||
MAASYASLSNISSISAPPRVSPFKTTSSLCSFASVKPQKYALSSLSSSKSFYGPLGLRSLRLDCPSRSRSDSMPFTLRAAAEEAALQSKVTHKVYFDISIGNPVGKLVGRIVIGLYGDDV PKTVENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLVHSGPGVISMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDVVRLNRKTRNRS W* | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 26,224.600 | ||
Theoretical pI: | 9.840 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
Instability index: | 41.444 | ||
aromaticity | 0.100 | ||
GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.320 | ||
sheet | 0.174 |