| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330685.1 | complete | 241 | 95-820(+) |
Amino Acid sequence : | |||
| MAASYASLSNISSISAPPRVSPFKTTSSLCSFASVKPQKYALSSLSSSKSFYGPLGLRSLRLDCPSRSRSDSMPFTLRAAAEEAALQSKVTHKVYFDISIGNPVGKLVGRIVIGLYGDDV PKTVENFRALCTGEKGFGYKGSSFHRVIKDFMIQGGDFDKGNGTGGKSIYGRTFKDENFQLVHSGPGVISMANAGPNTNGSQFFICTVKTPWLDQRHVVFGQVLEGMDVVRLNRKTRNRS W* | |||
Physicochemical properties | |||
| Number of amino acids: | 241 | ||
| Molecular weight: | 26,224.600 | ||
| Theoretical pI: | 9.840 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 41.444 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.241 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.320 | ||
| sheet | 0.174 | ||