| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330711.1 | 5prime_partial | 165 | 3-500(+) |
Amino Acid sequence : | |||
| KPPKKPNRTNLPQNHLRRREMSSEQIESHRANAEVYTGDAVCKQKSIELLEKINMPKGLLPLDDIVEVGHNAETGFVWLKQKKSKTHYFKGIGRSVWYDTEVTAFVSDRRMKRLTGVKSK EILIWITICDISIKDPESGKITFGTPTGISRAFPVSAFEEEEEKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 18,856.438 | ||
| Theoretical pI: | 9.301 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 60.342 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.673 | ||
Secondary Structure Fraction | |||
| Helix | 0.273 | ||
| turn | 0.224 | ||
| sheet | 0.218 | ||