Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330711.1 | 5prime_partial | 165 | 3-500(+) |
Amino Acid sequence : | |||
KPPKKPNRTNLPQNHLRRREMSSEQIESHRANAEVYTGDAVCKQKSIELLEKINMPKGLLPLDDIVEVGHNAETGFVWLKQKKSKTHYFKGIGRSVWYDTEVTAFVSDRRMKRLTGVKSK EILIWITICDISIKDPESGKITFGTPTGISRAFPVSAFEEEEEKK* | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 18,856.438 | ||
Theoretical pI: | 9.301 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 60.342 | ||
aromaticity | 0.073 | ||
GRAVY | -0.673 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.224 | ||
sheet | 0.218 |