| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330712.1 | 5prime_partial | 240 | 2-724(+) |
Amino Acid sequence : | |||
| SKAGNNSKKVVESKLPTAENELKFPINDSLLVGNGAGSSSNSNSAPPSSLPWIPYPAVDLTGVPPTLPSAPHMPFSPYTIPSPFSMPPPSPFMFRPPFSTPPPPGAIPPPPPPHGFFPPP PPPRGTGMRLSTPPPQPPPAEAVATTPHPAAKNQIEDKLLKELEEMGFKQVDLNKEVLRMNEYDLEQAVDDLCGVSEWDPILEELAEMGFHNTEVNKMLLKKNNGSIKRVVMDLIAGEEA * | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 17,248.217 | ||
| Theoretical pI: | 11.954 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 82.821 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.219 | ||
| sheet | 0.247 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330712.1 | 5prime_partial | 164 | 739-245(-) |
Amino Acid sequence : | |||
| FISTRLSLLAGDKVHNNALDAPIVLLQQHLVHLRVVETHLGELFEDRIPLRNAAKIIYCLFQIVLVHPQNFLVQIDLLEAHLLKFLEEFILDLILRGGVRCGGNSFCWRRLWWWCGETHT GSTWWWWGRKKTMWRRWWGNGAWWRWSRERWSEHERRWRWHGER* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 17,248.217 | ||
| Theoretical pI: | 11.954 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 82.821 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.219 | ||
| sheet | 0.247 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330712.1 | complete | 146 | 81-521(+) |
Amino Acid sequence : | |||
| MTACWLVMALALALTLTLRLPLHYRGFHILPSISLVFHQLSLRHLICLSRLTPFRHLSPCHLHRLSCSDHLSRLHRHQAPFPHHLRHMVFFRPHHHHVEPVCVSPHHHHSRLQQKLLPPH LTPPRRIKSRINSSRNLRRWASSKSI* | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 17,248.217 | ||
| Theoretical pI: | 11.954 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 82.821 | ||
| aromaticity | 0.062 | ||
| GRAVY | -0.208 | ||
Secondary Structure Fraction | |||
| Helix | 0.322 | ||
| turn | 0.219 | ||
| sheet | 0.247 | ||