Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330721.1 | 5prime_partial | 170 | 1-513(+) |
Amino Acid sequence : | |||
LIFHGRSATPTMNSTADSGGFLGSGNISGLGYGIGISVGILLLITTITLASYYCTRDNAPVLPQRNPPPDAAEIGIDEATLTGYPKLRYSEAKANRKDSAAACCSICLADYRSSDMVRVL PDCGHLFHVKCVDQWLRRHPTCPLCRTSPLPSPISTPLAEVVPLAARPIR* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 13,019.810 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 76.023 | ||
aromaticity | 0.027 | ||
GRAVY | -1.184 | ||
Secondary Structure Fraction | |||
Helix | 0.218 | ||
turn | 0.245 | ||
sheet | 0.264 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330721.1 | 5prime_partial | 110 | 3-335(+) |
Amino Acid sequence : | |||
NIPWPLRHPHHELHRRFRRLPRLRKHQRPRLRHRNLRRNPPPHHHHHVSLLLLHQRQRPRAAAAQSAARCGGDRNRRGDSDRLPEAPVLGGEGESQGFCRRLLLDLLGRL* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 13,019.810 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 76.023 | ||
aromaticity | 0.027 | ||
GRAVY | -1.184 | ||
Secondary Structure Fraction | |||
Helix | 0.218 | ||
turn | 0.245 | ||
sheet | 0.264 |