| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330733.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
| NKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSHALVISTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRRDRSRAKYKLVHVVRTHKGADDKAYKCVYEQEDPEGKVG INLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELGYIEAKGKNEE GRQSLADRFWERIQMQSAVWKCNRTNKTPTDG | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 12,916.941 | ||
| Theoretical pI: | 8.997 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 86.927 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.204 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330733.1 | 5prime_partial | 113 | 816-475(-) |
Amino Acid sequence : | |||
| PVGRRFVRPVAFPDGALHLNPLPKAICQTLSPFFIFPFGLDVPQFVPQRRRRRVAEAVECHPRRLHMLRRQLEVLLQLVDHRPPAGVDAEVLERLFEVGDVGLPFGVEDFPAY* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,916.941 | ||
| Theoretical pI: | 8.997 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 86.927 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.204 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330733.1 | internal | 272 | 1-816(+) |
Amino Acid sequence : | |||
| NKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSHALVISTEIITPNYYQGSERAMLLPNCLFRMGGAAILLSNKRRDRSRAKYKLVHVVRTHKGADDKAYKCVYEQEDPEGKVG INLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIFNPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELGYIEAKGKNEE GRQSLADRFWERIQMQSAVWKCNRTNKTPTDG | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 12,916.941 | ||
| Theoretical pI: | 8.997 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 86.927 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.204 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330733.1 | 5prime_partial | 113 | 816-475(-) |
Amino Acid sequence : | |||
| PVGRRFVRPVAFPDGALHLNPLPKAICQTLSPFFIFPFGLDVPQFVPQRRRRRVAEAVECHPRRLHMLRRQLEVLLQLVDHRPPAGVDAEVLERLFEVGDVGLPFGVEDFPAY* | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,916.941 | ||
| Theoretical pI: | 8.997 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 86.927 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.035 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.204 | ||
| sheet | 0.265 | ||