| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330735.1 | internal | 274 | 2-823(+) |
Amino Acid sequence : | |||
| PFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAL NVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIA | |||
Physicochemical properties | |||
| Number of amino acids: | 274 | ||
| Molecular weight: | 27,577.868 | ||
| Theoretical pI: | 5.533 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 48.146 | ||
| aromaticity | 0.011 | ||
| GRAVY | -0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.287 | ||
| sheet | 0.321 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330735.1 | 5prime_partial | 265 | 823-26(-) |
Amino Acid sequence : | |||
| GNHHISSPHKSIRQRVPATIQVIELALGDRIIDIEGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIISRAGVRQLPRLLVLLLRLHALVDQQSGI TAVVHDEIGAAARAPIEGPLGAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVG LGHVLDLVLAAGGGLLHLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 27,577.868 | ||
| Theoretical pI: | 5.533 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 48.146 | ||
| aromaticity | 0.011 | ||
| GRAVY | -0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.287 | ||
| sheet | 0.321 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330735.1 | internal | 274 | 2-823(+) |
Amino Acid sequence : | |||
| PFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAL NVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIA | |||
Physicochemical properties | |||
| Number of amino acids: | 274 | ||
| Molecular weight: | 27,577.868 | ||
| Theoretical pI: | 5.533 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 48.146 | ||
| aromaticity | 0.011 | ||
| GRAVY | -0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.287 | ||
| sheet | 0.321 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330735.1 | 5prime_partial | 265 | 823-26(-) |
Amino Acid sequence : | |||
| GNHHISSPHKSIRQRVPATIQVIELALGDRIIDIEGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIISRAGVRQLPRLLVLLLRLHALVDQQSGI TAVVHDEIGAAARAPIEGPLGAPPVLLQGLTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVG LGHVLDLVLAAGGGLLHLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 265 | ||
| Molecular weight: | 27,577.868 | ||
| Theoretical pI: | 5.533 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 48.146 | ||
| aromaticity | 0.011 | ||
| GRAVY | -0.006 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.287 | ||
| sheet | 0.321 | ||