Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330742.1 | 5prime_partial | 179 | 751-212(-) |
Amino Acid sequence : | |||
QRAMTEMNGVVCSSRPMRIGPAANKKPMNAPTNTASYQSSQGSQGESDPNNTTIFVGGLDPNVSDDHLRQVFSQYGEVVHVKIPVGKRCGFVQFSDRSCAEQALSNLNGTLLGGQNIRLS WGRSPSNKQTQDQTQWGGGGAYYGYTQGHEVQGGFAPPQDPNMYYGGYPGYANYQQPQQ* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 12,558.218 | ||
Theoretical pI: | 6.613 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 32.532 | ||
aromaticity | 0.101 | ||
GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.211 | ||
sheet | 0.239 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330742.1 | complete | 109 | 328-657(+) |
Amino Acid sequence : | |||
MLHHHPTGSGPESACLKGCDPMRVGYSALLVEYHLSSITLAQHRTCQKTEQIHSAFQLVFLHVLPRHTGRILVSNGHLIHWGLDHQQILLYYSDHFLPDFPENFDMKQY* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 12,558.218 | ||
Theoretical pI: | 6.613 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 32.532 | ||
aromaticity | 0.101 | ||
GRAVY | -0.238 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.211 | ||
sheet | 0.239 |