Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330747.1	complete	151	3-458(+)
Amino Acid sequence :
MLLGRTSPDPADQGAWILTFSTRYQDAWNDLVQEGLISSEKRDTFNIPIYTPSLEEFKEVVERDGAFIINKLQLFHGGSALIIDDPNDAVEISRAYVSLCRSLTGGLVDAHIGDQLGHEL FSRLLSQAVDQAKELMDQFQLVHIVASLTLA*
Physicochemical properties
Number of amino acids:		151
Molecular weight:		16,759.731
Theoretical pI:		4.555
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		15470 15470
Instability index:		39.790
aromaticity		0.079
GRAVY		-0.025
Secondary Structure Fraction
Helix		0.344
turn		0.205
sheet		0.285