Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330750.1 | complete | 102 | 205-513(+) |
Amino Acid sequence : | |||
MRIGVITYNIIVCSSRSGGEVGMVVELGKEEGAWIQFAVEAHYSMGSASQRMVVACSQGSLYAVGAGEEDMLDSKRGHDKDVLVLVSNHKQEFGHRLEALPR* | |||
Physicochemical properties | |||
Number of amino acids: | 102 | ||
Molecular weight: | 11,081.511 | ||
Theoretical pI: | 5.743 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 48.811 | ||
aromaticity | 0.059 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.245 | ||
sheet | 0.284 |