| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330751.1 | 5prime_partial | 145 | 1-438(+) |
Amino Acid sequence : | |||
| LNNEQDWRYGLRVKLLKKMNKPGQKKNNWREPQHDRGSTVQTTEPAASEEAHDASEHHDDSHNEEDVDHISREKNGTHLPKEKNGHKGRNRGRGRRQMHHNTNGHGHGAQHSGHGVEPSK PPPGPRMPDGTRGFTMGRGRPLATV* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 13,107.541 | ||
| Theoretical pI: | 8.338 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 61.053 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.207 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330751.1 | complete | 116 | 155-505(+) |
Amino Acid sequence : | |||
| MMQVNITMIHTMRRMWIIYLERKMGHTCPKRKMVTKVETEDVGGDKCITTQMGMAMELNIPAMVLNHQSRHQAPGCLMEPEGSPWAGGGLWRPCEIDGNILVDMKIHLSCVKPLAT* | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 13,107.541 | ||
| Theoretical pI: | 8.338 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
| Instability index: | 61.053 | ||
| aromaticity | 0.034 | ||
| GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
| Helix | 0.241 | ||
| turn | 0.207 | ||
| sheet | 0.284 | ||