Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330751.1 | 5prime_partial | 145 | 1-438(+) |
Amino Acid sequence : | |||
LNNEQDWRYGLRVKLLKKMNKPGQKKNNWREPQHDRGSTVQTTEPAASEEAHDASEHHDDSHNEEDVDHISREKNGTHLPKEKNGHKGRNRGRGRRQMHHNTNGHGHGAQHSGHGVEPSK PPPGPRMPDGTRGFTMGRGRPLATV* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 13,107.541 | ||
Theoretical pI: | 8.338 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 61.053 | ||
aromaticity | 0.034 | ||
GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.207 | ||
sheet | 0.284 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330751.1 | complete | 116 | 155-505(+) |
Amino Acid sequence : | |||
MMQVNITMIHTMRRMWIIYLERKMGHTCPKRKMVTKVETEDVGGDKCITTQMGMAMELNIPAMVLNHQSRHQAPGCLMEPEGSPWAGGGLWRPCEIDGNILVDMKIHLSCVKPLAT* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,107.541 | ||
Theoretical pI: | 8.338 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 61.053 | ||
aromaticity | 0.034 | ||
GRAVY | -0.151 | ||
Secondary Structure Fraction | |||
Helix | 0.241 | ||
turn | 0.207 | ||
sheet | 0.284 |