| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330754.1 | 5prime_partial | 162 | 618-130(-) |
Amino Acid sequence : | |||
| KNVDILGVELAKSAVQIPLVWNIQVSTWLRHYVYERLIQKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVLYRWQQATQISLFKNLLGLFNFAYTLLVLNYSAVGFMV LSLHETLTAYGSVYYIGSILPIVLILLGKIIKPPRSKARKQE* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 18,392.617 | ||
| Theoretical pI: | 9.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 36900 | ||
| Instability index: | 27.178 | ||
| aromaticity | 0.136 | ||
| GRAVY | 0.452 | ||
Secondary Structure Fraction | |||
| Helix | 0.463 | ||
| turn | 0.204 | ||
| sheet | 0.253 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330754.1 | 5prime_partial | 162 | 618-130(-) |
Amino Acid sequence : | |||
| KNVDILGVELAKSAVQIPLVWNIQVSTWLRHYVYERLIQKGKKPGFFQLLATQTVSAVWHGLYPGYIIFFVQSALMIAGSRVLYRWQQATQISLFKNLLGLFNFAYTLLVLNYSAVGFMV LSLHETLTAYGSVYYIGSILPIVLILLGKIIKPPRSKARKQE* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 18,392.617 | ||
| Theoretical pI: | 9.995 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36900 36900 | ||
| Instability index: | 27.178 | ||
| aromaticity | 0.136 | ||
| GRAVY | 0.452 | ||
Secondary Structure Fraction | |||
| Helix | 0.463 | ||
| turn | 0.204 | ||
| sheet | 0.253 | ||