| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330791.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| QVLHLHAMEVLQASSLSFQLLRRHSRNNLINKFRNPSLPRIHMPRQNIDLKTFAAITPTVACPPSEPEIIPEKKEDKFEWYENWYPVASVCDLDKRRPHGRKVIGIDVVVWWDRKENAWK VFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIFLTKKPHYIPELDDPSFTCTMTTREVPYGYEILA | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 27,820.691 | ||
| Theoretical pI: | 8.683 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 61420 61920 | ||
| Instability index: | 51.154 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.229 | ||
| sheet | 0.188 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330791.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
| QVLHLHAMEVLQASSLSFQLLRRHSRNNLINKFRNPSLPRIHMPRQNIDLKTFAAITPTVACPPSEPEIIPEKKEDKFEWYENWYPVASVCDLDKRRPHGRKVIGIDVVVWWDRKENAWK VFDDTCPHRLAPLSEGRIDQWGRLQCVYHGWCFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIFLTKKPHYIPELDDPSFTCTMTTREVPYGYEILA | |||
Physicochemical properties | |||
| Number of amino acids: | 240 | ||
| Molecular weight: | 27,820.691 | ||
| Theoretical pI: | 8.683 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 61420 61920 | ||
| Instability index: | 51.154 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.491 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.229 | ||
| sheet | 0.188 | ||