Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330792.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
VTQACYVGKVRDYASENGVNVVCVDSPAPEDCLQFSDLISGDEHDLPAVKISPDDVVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSDDVIICVLPFFHIYSLNSILLC GLRAGAAILLIQKFDIAPFLELIQRYKVTIGPFVPPMVLAIAKSPVVDKYDLSSVRTVMSGAAPLGKELEEAVRNKFPNAKLGQGYGMTEAGPVLAMCLAFAKEPFEIKSGSCGTVVRNA | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 25,613.404 | ||
Theoretical pI: | 5.205 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12295 | ||
Instability index: | 43.990 | ||
aromaticity | 0.071 | ||
GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.254 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330792.1 | internal | 240 | 1-720(+) |
Amino Acid sequence : | |||
VTQACYVGKVRDYASENGVNVVCVDSPAPEDCLQFSDLISGDEHDLPAVKISPDDVVALPYSSGTTGLPKGVMLTHKGLVTSVAQQVDGENPNLYIHSDDVIICVLPFFHIYSLNSILLC GLRAGAAILLIQKFDIAPFLELIQRYKVTIGPFVPPMVLAIAKSPVVDKYDLSSVRTVMSGAAPLGKELEEAVRNKFPNAKLGQGYGMTEAGPVLAMCLAFAKEPFEIKSGSCGTVVRNA | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 25,613.404 | ||
Theoretical pI: | 5.205 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11920 12295 | ||
Instability index: | 43.990 | ||
aromaticity | 0.071 | ||
GRAVY | 0.258 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.254 | ||
sheet | 0.254 |