| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330799.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| TLSHLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQ GVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVFPAK | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 26,031.154 | ||
| Theoretical pI: | 5.141 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 37.755 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.203 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330799.1 | internal | 237 | 1-711(+) |
Amino Acid sequence : | |||
| TLSHLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQ GVHGHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVFPAK | |||
Physicochemical properties | |||
| Number of amino acids: | 237 | ||
| Molecular weight: | 26,031.154 | ||
| Theoretical pI: | 5.141 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
| Instability index: | 37.755 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.398 | ||
Secondary Structure Fraction | |||
| Helix | 0.257 | ||
| turn | 0.203 | ||
| sheet | 0.224 | ||