| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330808.1 | internal | 208 | 1-624(+) |
Amino Acid sequence : | |||
| EMATPMVEDTFEDDQLSSMTTEDITRASRLLDNEIRILKEELQRTNLELDSFREKIKENQEKIKLNKQLPYLVGNIVEILEMNPEEEAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPV VGLVDPDTLKPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKERFQKLGVRPPKESF | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 23,779.675 | ||
| Theoretical pI: | 4.521 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 47.238 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.611 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.188 | ||
| sheet | 0.303 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330808.1 | internal | 208 | 1-624(+) |
Amino Acid sequence : | |||
| EMATPMVEDTFEDDQLSSMTTEDITRASRLLDNEIRILKEELQRTNLELDSFREKIKENQEKIKLNKQLPYLVGNIVEILEMNPEEEAEEDGANIDLDSQRKGKCVVLKTSTRQTIFLPV VGLVDPDTLKPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKERFQKLGVRPPKESF | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 23,779.675 | ||
| Theoretical pI: | 4.521 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
| Instability index: | 47.238 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.611 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.188 | ||
| sheet | 0.303 | ||