| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330812.1 | internal | 234 | 3-704(+) |
Amino Acid sequence : | |||
| KDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEP ERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEXAGITVIQID | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 26,176.505 | ||
| Theoretical pI: | 8.488 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 43.893 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.429 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.210 | ||
| sheet | 0.262 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330812.1 | internal | 234 | 3-704(+) |
Amino Acid sequence : | |||
| KDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEP ERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFWSTAAQSMTKRPMKGMLTGPVTILNWSFVRNDQPRFETCYQIALAIKDEVEDLEXAGITVIQID | |||
Physicochemical properties | |||
| Number of amino acids: | 234 | ||
| Molecular weight: | 26,176.505 | ||
| Theoretical pI: | 8.488 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 43.893 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.429 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.210 | ||
| sheet | 0.262 | ||