| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330817.1 | 5prime_partial | 114 | 3-347(+) |
Amino Acid sequence : | |||
| CFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIFLTKKPHYIPELDDPSFTCTMTTREVPYGYEILAENLMDPSHVPYAHYGILELEKVKER* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,957.746 | ||
| Theoretical pI: | 6.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 43.182 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.436 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.246 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330817.1 | 5prime_partial | 114 | 3-347(+) |
Amino Acid sequence : | |||
| CFDGAGACKFIPQAPHHGPPVETSKKACVKGVYPSCVRNGIVWFWPNSDPKYKDIFLTKKPHYIPELDDPSFTCTMTTREVPYGYEILAENLMDPSHVPYAHYGILELEKVKER* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 12,957.746 | ||
| Theoretical pI: | 6.558 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 43.182 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.436 | ||
Secondary Structure Fraction | |||
| Helix | 0.298 | ||
| turn | 0.246 | ||
| sheet | 0.193 | ||