| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330834.1 | 5prime_partial | 192 | 679-101(-) |
Amino Acid sequence : | |||
| SAAPHFPEKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGGDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 14,791.367 | ||
| Theoretical pI: | 4.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
| Instability index: | 39.925 | ||
| aromaticity | 0.088 | ||
| GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
| Helix | 0.169 | ||
| turn | 0.324 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330834.1 | complete | 155 | 137-604(+) |
Amino Acid sequence : | |||
| MQSRLFLDVIISQRTPILQLLPSKDQPLLIRWNAFLILDLRLHVINGVRALHLQSDRLSSQRLHEDLHSTTQPQHQMQGRLLLDIVVRQSPPIFQLFASEDQPLLIRWDSFLVLYLCLHV VDCIRALHFQRDRLAGQSFDEDLHPSTKPQNQMQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 14,791.367 | ||
| Theoretical pI: | 4.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
| Instability index: | 39.925 | ||
| aromaticity | 0.088 | ||
| GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
| Helix | 0.169 | ||
| turn | 0.324 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330834.1 | 5prime_partial | 136 | 680-270(-) |
Amino Acid sequence : | |||
| ISSASFSRKAAGGWQNPGRLQHPEGINSAFGSEASWRDANLRQNSDRQDDHAGSGELGYNRQREGKDTGQGRNPTGSAEADLRWQTAGRWEDSGGLQYPEGVDLASGAEAAWWNADLRED ADWKDDHFGGGELGHH* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,791.367 | ||
| Theoretical pI: | 4.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
| Instability index: | 39.925 | ||
| aromaticity | 0.088 | ||
| GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
| Helix | 0.169 | ||
| turn | 0.324 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330834.1 | 5prime_partial | 192 | 679-101(-) |
Amino Acid sequence : | |||
| SAAPHFPEKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGGDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 192 | ||
| Molecular weight: | 14,791.367 | ||
| Theoretical pI: | 4.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
| Instability index: | 39.925 | ||
| aromaticity | 0.088 | ||
| GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
| Helix | 0.169 | ||
| turn | 0.324 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330834.1 | complete | 155 | 137-604(+) |
Amino Acid sequence : | |||
| MQSRLFLDVIISQRTPILQLLPSKDQPLLIRWNAFLILDLRLHVINGVRALHLQSDRLSSQRLHEDLHSTTQPQHQMQGRLLLDIVVRQSPPIFQLFASEDQPLLIRWDSFLVLYLCLHV VDCIRALHFQRDRLAGQSFDEDLHPSTKPQNQMQS* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 14,791.367 | ||
| Theoretical pI: | 4.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
| Instability index: | 39.925 | ||
| aromaticity | 0.088 | ||
| GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
| Helix | 0.169 | ||
| turn | 0.324 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330834.1 | 5prime_partial | 136 | 680-270(-) |
Amino Acid sequence : | |||
| ISSASFSRKAAGGWQNPGRLQHPEGINSAFGSEASWRDANLRQNSDRQDDHAGSGELGYNRQREGKDTGQGRNPTGSAEADLRWQTAGRWEDSGGLQYPEGVDLASGAEAAWWNADLRED ADWKDDHFGGGELGHH* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 14,791.367 | ||
| Theoretical pI: | 4.887 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
| Instability index: | 39.925 | ||
| aromaticity | 0.088 | ||
| GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
| Helix | 0.169 | ||
| turn | 0.324 | ||
| sheet | 0.250 | ||