Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330834.1 | 5prime_partial | 192 | 679-101(-) |
Amino Acid sequence : | |||
SAAPHFPEKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGGDI* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 14,791.367 | ||
Theoretical pI: | 4.887 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
Instability index: | 39.925 | ||
aromaticity | 0.088 | ||
GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.324 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330834.1 | complete | 155 | 137-604(+) |
Amino Acid sequence : | |||
MQSRLFLDVIISQRTPILQLLPSKDQPLLIRWNAFLILDLRLHVINGVRALHLQSDRLSSQRLHEDLHSTTQPQHQMQGRLLLDIVVRQSPPIFQLFASEDQPLLIRWDSFLVLYLCLHV VDCIRALHFQRDRLAGQSFDEDLHPSTKPQNQMQS* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 14,791.367 | ||
Theoretical pI: | 4.887 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
Instability index: | 39.925 | ||
aromaticity | 0.088 | ||
GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.324 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330834.1 | 5prime_partial | 136 | 680-270(-) |
Amino Acid sequence : | |||
ISSASFSRKAAGGWQNPGRLQHPEGINSAFGSEASWRDANLRQNSDRQDDHAGSGELGYNRQREGKDTGQGRNPTGSAEADLRWQTAGRWEDSGGLQYPEGVDLASGAEAAWWNADLRED ADWKDDHFGGGELGHH* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 14,791.367 | ||
Theoretical pI: | 4.887 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
Instability index: | 39.925 | ||
aromaticity | 0.088 | ||
GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.324 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330834.1 | 5prime_partial | 192 | 679-101(-) |
Amino Acid sequence : | |||
SAAPHFPEKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT LTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGGDI* | |||
Physicochemical properties | |||
Number of amino acids: | 192 | ||
Molecular weight: | 14,791.367 | ||
Theoretical pI: | 4.887 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
Instability index: | 39.925 | ||
aromaticity | 0.088 | ||
GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.324 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330834.1 | complete | 155 | 137-604(+) |
Amino Acid sequence : | |||
MQSRLFLDVIISQRTPILQLLPSKDQPLLIRWNAFLILDLRLHVINGVRALHLQSDRLSSQRLHEDLHSTTQPQHQMQGRLLLDIVVRQSPPIFQLFASEDQPLLIRWDSFLVLYLCLHV VDCIRALHFQRDRLAGQSFDEDLHPSTKPQNQMQS* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 14,791.367 | ||
Theoretical pI: | 4.887 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
Instability index: | 39.925 | ||
aromaticity | 0.088 | ||
GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.324 | ||
sheet | 0.250 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330834.1 | 5prime_partial | 136 | 680-270(-) |
Amino Acid sequence : | |||
ISSASFSRKAAGGWQNPGRLQHPEGINSAFGSEASWRDANLRQNSDRQDDHAGSGELGYNRQREGKDTGQGRNPTGSAEADLRWQTAGRWEDSGGLQYPEGVDLASGAEAAWWNADLRED ADWKDDHFGGGELGHH* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 14,791.367 | ||
Theoretical pI: | 4.887 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 41480 41480 | ||
Instability index: | 39.925 | ||
aromaticity | 0.088 | ||
GRAVY | -1.212 | ||
Secondary Structure Fraction | |||
Helix | 0.169 | ||
turn | 0.324 | ||
sheet | 0.250 |