| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330839.1 | internal | 256 | 2-769(+) |
Amino Acid sequence : | |||
| RELSDLQTLRSHYQPQLPPCLQGNAIRVEFGDETTTADPSGAHTISRSFPHTYGQPLAHFLKATVTVPEAQIISDYPSVRVGVVFCGRQSPGGHNVIWGLFEALKFHNPESVLLGFLGGS EGLFAQKTLEISDEILATYKNQGGYDLLGRTKDQIRTTKQVDAALKACTDLKLDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIPVTLNGDLKNQFVETNVGFDTICKVNSQLISNV CTDALSAEKYYYFIRL | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 27,937.363 | ||
| Theoretical pI: | 5.878 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17795 | ||
| Instability index: | 37.474 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.227 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330839.1 | internal | 256 | 2-769(+) |
Amino Acid sequence : | |||
| RELSDLQTLRSHYQPQLPPCLQGNAIRVEFGDETTTADPSGAHTISRSFPHTYGQPLAHFLKATVTVPEAQIISDYPSVRVGVVFCGRQSPGGHNVIWGLFEALKFHNPESVLLGFLGGS EGLFAQKTLEISDEILATYKNQGGYDLLGRTKDQIRTTKQVDAALKACTDLKLDALVIIGGVTSNTDAAQLAETFAERKCPTKVVGIPVTLNGDLKNQFVETNVGFDTICKVNSQLISNV CTDALSAEKYYYFIRL | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 27,937.363 | ||
| Theoretical pI: | 5.878 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17795 | ||
| Instability index: | 37.474 | ||
| aromaticity | 0.082 | ||
| GRAVY | -0.123 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.227 | ||
| sheet | 0.230 | ||