| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330853.1 | complete | 230 | 1-693(+) |
Amino Acid sequence : | |||
| MARLDRVKNLTGLVELYAKSPKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYDLIETYKLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATLHG GPAEIIVDGKSGFHIDPYNGEQVAETLVSFFEKCKKDASHWETISAGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKYVSKLDRQEIRRYLEMFYALKYRKLAEAVPRAVE* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 13,412.461 | ||
| Theoretical pI: | 7.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 42.138 | ||
| aromaticity | 0.025 | ||
| GRAVY | 0.058 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.242 | ||
| sheet | 0.308 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330853.1 | complete | 120 | 480-118(-) |
Amino Acid sequence : | |||
| MRSILLALLKEANQRLRHLLPIVRVNVESGLAINDDLRGPTVESGESWEPTRHGLNHSQPKGLVECRLHKGASRVSNVSVELTVSHAVHLGRDPSELPIQLVCLYQIIHLLHLSLLFQIL * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,412.461 | ||
| Theoretical pI: | 7.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 42.138 | ||
| aromaticity | 0.025 | ||
| GRAVY | 0.058 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.242 | ||
| sheet | 0.308 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330853.1 | complete | 230 | 1-693(+) |
Amino Acid sequence : | |||
| MARLDRVKNLTGLVELYAKSPKLRELVNLVVVGGDRRKESKDLEEQAEMKKMYDLIETYKLNGQFRWISSQMNRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATLHG GPAEIIVDGKSGFHIDPYNGEQVAETLVSFFEKCKKDASHWETISAGGLKRIQEKYTWQIYSDRLLTLAGVYGFWKYVSKLDRQEIRRYLEMFYALKYRKLAEAVPRAVE* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 13,412.461 | ||
| Theoretical pI: | 7.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 42.138 | ||
| aromaticity | 0.025 | ||
| GRAVY | 0.058 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.242 | ||
| sheet | 0.308 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330853.1 | complete | 120 | 480-118(-) |
Amino Acid sequence : | |||
| MRSILLALLKEANQRLRHLLPIVRVNVESGLAINDDLRGPTVESGESWEPTRHGLNHSQPKGLVECRLHKGASRVSNVSVELTVSHAVHLGRDPSELPIQLVCLYQIIHLLHLSLLFQIL * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,412.461 | ||
| Theoretical pI: | 7.937 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 42.138 | ||
| aromaticity | 0.025 | ||
| GRAVY | 0.058 | ||
Secondary Structure Fraction | |||
| Helix | 0.367 | ||
| turn | 0.242 | ||
| sheet | 0.308 | ||