| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330859.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| YKTLTSLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAGVVDGRNIWANDLAASITTLHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGH KDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDID | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 25,325.558 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 36.694 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.210 | ||
| sheet | 0.296 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330859.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
| YKTLTSLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAGVVDGRNIWANDLAASITTLHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGH KDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDID | |||
Physicochemical properties | |||
| Number of amino acids: | 233 | ||
| Molecular weight: | 25,325.558 | ||
| Theoretical pI: | 9.300 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
| Instability index: | 36.694 | ||
| aromaticity | 0.060 | ||
| GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.210 | ||
| sheet | 0.296 | ||