Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330859.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
YKTLTSLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAGVVDGRNIWANDLAASITTLHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGH KDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDID | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 25,325.558 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 36.694 | ||
aromaticity | 0.060 | ||
GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.210 | ||
sheet | 0.296 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330859.1 | internal | 233 | 1-699(+) |
Amino Acid sequence : | |||
YKTLTSLSGISGYGFDLVRGAQTIDLIKGGFPSGKYLFAGVVDGRNIWANDLAASITTLHALEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDQEIKSWLAFAAQKIVEVNALAKALAGH KDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANKISEEEYIKAIKEEINKVVKLQEELDID | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 25,325.558 | ||
Theoretical pI: | 9.300 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 16960 | ||
Instability index: | 36.694 | ||
aromaticity | 0.060 | ||
GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.210 | ||
sheet | 0.296 |