Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330875.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
IDRNTMLRIASRRLSTSLWRPTNTTAAVSAAIPRLPDGGDATGTYSSPCSFPFGSHTHSLFHLPFRGFASDSITPKKEDSSIPQVPPTVAAIRNPTPKIVYDEHNHERYRPGDPSKRAFA YFVLTGGRFVYASLARLLILKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEEDVKLANSVNLGSLRDPQEDSERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGW FCPCPGSHYDISGRIR | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 11,723.299 | ||
Theoretical pI: | 11.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 44.255 | ||
aromaticity | 0.039 | ||
GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.272 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330875.1 | complete | 167 | 686-183(-) |
Amino Acid sequence : | |||
MQPKCVHTPTTTSHSGFFTLSESSCGSRRLPRLTLFANFTSSSVLLLMNTGFPRHFTVTVVPGSMLDRSTSREARARTSLLADMLRTNFSISSRAREAYTNLPPVNTKYANARLLGSPGL YRSWLCSSYTIFGVGFLIAATVGGTCGMELSSFFGVIESEAKPLKGR* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 11,723.299 | ||
Theoretical pI: | 11.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 44.255 | ||
aromaticity | 0.039 | ||
GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.272 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330875.1 | 5prime_partial | 103 | 768-457(-) |
Amino Acid sequence : | |||
SNSPRYIIMRARAGTKPSSKITRIRQRNATQMRAHPDHNEPLRILHPLRVLLRVTKTPQINTVCQLHILFSPPPDEHWLSTPLHGHSGTRFDAGQIHLEGSQS* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,723.299 | ||
Theoretical pI: | 11.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 44.255 | ||
aromaticity | 0.039 | ||
GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.272 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330875.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
IDRNTMLRIASRRLSTSLWRPTNTTAAVSAAIPRLPDGGDATGTYSSPCSFPFGSHTHSLFHLPFRGFASDSITPKKEDSSIPQVPPTVAAIRNPTPKIVYDEHNHERYRPGDPSKRAFA YFVLTGGRFVYASLARLLILKFVLSMSASKDVLALASLEVDLSSIEPGTTVTVKWRGKPVFIRRRTEEDVKLANSVNLGSLRDPQEDSERVKNPEWLVVVGVCTHLGCIPLPNAGDFGGW FCPCPGSHYDISGRIR | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 11,723.299 | ||
Theoretical pI: | 11.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 44.255 | ||
aromaticity | 0.039 | ||
GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.272 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330875.1 | complete | 167 | 686-183(-) |
Amino Acid sequence : | |||
MQPKCVHTPTTTSHSGFFTLSESSCGSRRLPRLTLFANFTSSSVLLLMNTGFPRHFTVTVVPGSMLDRSTSREARARTSLLADMLRTNFSISSRAREAYTNLPPVNTKYANARLLGSPGL YRSWLCSSYTIFGVGFLIAATVGGTCGMELSSFFGVIESEAKPLKGR* | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 11,723.299 | ||
Theoretical pI: | 11.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 44.255 | ||
aromaticity | 0.039 | ||
GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.272 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330875.1 | 5prime_partial | 103 | 768-457(-) |
Amino Acid sequence : | |||
SNSPRYIIMRARAGTKPSSKITRIRQRNATQMRAHPDHNEPLRILHPLRVLLRVTKTPQINTVCQLHILFSPPPDEHWLSTPLHGHSGTRFDAGQIHLEGSQS* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,723.299 | ||
Theoretical pI: | 11.388 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 44.255 | ||
aromaticity | 0.039 | ||
GRAVY | -0.663 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.272 | ||
sheet | 0.194 |