| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330901.1 | internal | 243 | 3-731(+) |
Amino Acid sequence : | |||
| GDVKKEDIDRINNKVTSILNEEFLSSKDYVPQRRDWLSAYWAGFKSPEQLSRLRNTGVKPEILKNVGKAITTLPETFKPHRAVKRIFEDRAKMIETGEGIDWALGEALAFATLLVEGNHV RLSGQDVERGTFSHRHSVLHDQETGEKYCPLDHVVMNQNEEMFTVSNSSLSEFGVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVMFDQFLSSGEAKWLRQTGIVVLLPHGYDGQGSEH SSA | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 27,307.242 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 34950 | ||
| Instability index: | 33.035 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.255 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330901.1 | internal | 243 | 3-731(+) |
Amino Acid sequence : | |||
| GDVKKEDIDRINNKVTSILNEEFLSSKDYVPQRRDWLSAYWAGFKSPEQLSRLRNTGVKPEILKNVGKAITTLPETFKPHRAVKRIFEDRAKMIETGEGIDWALGEALAFATLLVEGNHV RLSGQDVERGTFSHRHSVLHDQETGEKYCPLDHVVMNQNEEMFTVSNSSLSEFGVLGFELGYSMENPNSLVLWEAQFGDFSNGAQVMFDQFLSSGEAKWLRQTGIVVLLPHGYDGQGSEH SSA | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 27,307.242 | ||
| Theoretical pI: | 5.304 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34950 34950 | ||
| Instability index: | 33.035 | ||
| aromaticity | 0.095 | ||
| GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.255 | ||
| sheet | 0.259 | ||