Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330902.1 | complete | 179 | 188-727(+) |
Amino Acid sequence : | |||
MSKWKGEYLLDIKIHLLSMTTSSEIYVYFSIKLVVQRLKTDGIRLHSFLDYLSLLFRVNLIEASCSGGRWSTANILDVVDVTSVHSFHCSAKTRCDVAVCTHVHGLFLAPNNLCIRISFE FTLDEVKWEGGKLLHPTDCNVLSTNLFPLFVELVIHLSRAKNETSNTLFKVRVIILVLY* | |||
Physicochemical properties | |||
Number of amino acids: | 179 | ||
Molecular weight: | 16,692.922 | ||
Theoretical pI: | 7.862 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 38.303 | ||
aromaticity | 0.082 | ||
GRAVY | -0.560 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.192 | ||
sheet | 0.253 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330902.1 | 5prime_partial | 146 | 739-299(-) |
Amino Acid sequence : | |||
RFKRLIKDQNDHSDLEEGIRRLVLCSGKVYYELDEERKKVGGKDIAICRVEQLSPFPFDLVQRELKRYPNAEVVWCQEEPMNMGAYSYIAPRLGTAMKAVNRGNIDDIKYVGRAPSAATA TGFYQVHTKEQTEIVQKAMQPDPISL* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 16,692.922 | ||
Theoretical pI: | 7.862 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 38.303 | ||
aromaticity | 0.082 | ||
GRAVY | -0.560 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.192 | ||
sheet | 0.253 |