| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330908.1 | internal | 227 | 683-3(-) |
Amino Acid sequence : | |||
| VEVENGLLIKVFFRDNRLDHMLLQIRSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLHGHLSLAVRPQPRARPVFPNLSETGAELRGKNMTQRHQLRGFIRGVAKHVALITSTDFLRA FGEVAMYTLSNIRALLLNIHQNLAVIRIKTYIIGDKSNGTACVTDNLLVVDISLGGYFSKHHDHVGFGAGLTSNLALRVLSKAGVQHRIGDLIAELVRVPLIHRLRC | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 25,015.923 | ||
| Theoretical pI: | 4.813 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 32.971 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.181 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330908.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| TSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHM FGYATDETPELMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDKTVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLN | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 25,015.923 | ||
| Theoretical pI: | 4.813 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 32.971 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.181 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330908.1 | internal | 227 | 683-3(-) |
Amino Acid sequence : | |||
| VEVENGLLIKVFFRDNRLDHMLLQIRSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLHGHLSLAVRPQPRARPVFPNLSETGAELRGKNMTQRHQLRGFIRGVAKHVALITSTDFLRA FGEVAMYTLSNIRALLLNIHQNLAVIRIKTYIIGDKSNGTACVTDNLLVVDISLGGYFSKHHDHVGFGAGLTSNLALRVLSKAGVQHRIGDLIAELVRVPLIHRLRC | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 25,015.923 | ||
| Theoretical pI: | 4.813 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 32.971 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.181 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330908.1 | internal | 227 | 3-683(+) |
Amino Acid sequence : | |||
| TSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHM FGYATDETPELMPLSHVLATKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTVLISTQHDKTVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLN | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 25,015.923 | ||
| Theoretical pI: | 4.813 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 32.971 | ||
| aromaticity | 0.044 | ||
| GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
| Helix | 0.269 | ||
| turn | 0.181 | ||
| sheet | 0.238 | ||