Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330912.1 | 5prime_partial | 191 | 3-578(+) |
Amino Acid sequence : | |||
FDLSFKTACKPQIIKPPPLKKKRRSTSQPTPIFFSEPNTQSNSFVGTEEYIAPEIITGEGHSSAIDWWALGILLYEMIYGRTPFRGKNRQKTFANIIHKDLTFPSSIQVSLQARQLIHAL LHRDPASRLGSNSGANEIKEHPFFKGINWPLIRCMSPPPLDAPLELIGKEEGKKDVNWTDEGVLVHPMEMF* | |||
Physicochemical properties | |||
Number of amino acids: | 191 | ||
Molecular weight: | 21,609.617 | ||
Theoretical pI: | 8.875 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 51.068 | ||
aromaticity | 0.094 | ||
GRAVY | -0.404 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.277 | ||
sheet | 0.225 |