| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330918.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
| SSSFSEREIRRETCPISCTMSLLTDLINLNLSESTDMIIAEYVWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGVDSEVILYPQAIFRDPFRRGNNILVICDAYTPAGEP IPTNHRHNAAKIFSHPDVAKEVPWYGIEQEYTLLKKDVKWPLGWPVGGYPGPQGPYYCGIGVDKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDELWIARYIL ERITENAGVVVSFD | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 11,662.378 | ||
| Theoretical pI: | 9.684 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 66.283 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.301 | ||
| sheet | 0.175 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330918.1 | complete | 103 | 582-271(-) |
Amino Acid sequence : | |||
| MRIDNITPKGLVYSDSTVIWALRSRITTNRPSKRPLNILFQQSVFLLNTIPWDLLGNIRMAENLGCIVSVVRWNRLTSGSVSITYDQNIISPSERISENCLGI* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,662.378 | ||
| Theoretical pI: | 9.684 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 66.283 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.301 | ||
| sheet | 0.175 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330918.1 | internal | 254 | 1-762(+) |
Amino Acid sequence : | |||
| SSSFSEREIRRETCPISCTMSLLTDLINLNLSESTDMIIAEYVWIGGSGMDMRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGVDSEVILYPQAIFRDPFRRGNNILVICDAYTPAGEP IPTNHRHNAAKIFSHPDVAKEVPWYGIEQEYTLLKKDVKWPLGWPVGGYPGPQGPYYCGIGVDKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDELWIARYIL ERITENAGVVVSFD | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 11,662.378 | ||
| Theoretical pI: | 9.684 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 66.283 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.301 | ||
| sheet | 0.175 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330918.1 | complete | 103 | 582-271(-) |
Amino Acid sequence : | |||
| MRIDNITPKGLVYSDSTVIWALRSRITTNRPSKRPLNILFQQSVFLLNTIPWDLLGNIRMAENLGCIVSVVRWNRLTSGSVSITYDQNIISPSERISENCLGI* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 11,662.378 | ||
| Theoretical pI: | 9.684 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19605 | ||
| Instability index: | 66.283 | ||
| aromaticity | 0.068 | ||
| GRAVY | 0.030 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.301 | ||
| sheet | 0.175 | ||