| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330920.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| SITPFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSA AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLFQMQANGTLLF PAINVNDS | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 24,422.300 | ||
| Theoretical pI: | 5.287 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.759 | ||
| aromaticity | 0.013 | ||
| GRAVY | -0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.288 | ||
| sheet | 0.335 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330920.1 | 5prime_partial | 236 | 746-36(-) |
Amino Acid sequence : | |||
| RIIDIDGREKQSAISLHLKQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIISRAGVRQLPRLLVLLLRLHALVDQQSGITAVVHDEIGAAARAPIEGPLGAPPVLLQG LTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAAGGGLLHLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 24,422.300 | ||
| Theoretical pI: | 5.287 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.759 | ||
| aromaticity | 0.013 | ||
| GRAVY | -0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.288 | ||
| sheet | 0.335 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330920.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| SITPFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSA AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKTGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLFQMQANGTLLF PAINVNDS | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 24,422.300 | ||
| Theoretical pI: | 5.287 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.759 | ||
| aromaticity | 0.013 | ||
| GRAVY | -0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.288 | ||
| sheet | 0.335 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330920.1 | 5prime_partial | 236 | 746-36(-) |
Amino Acid sequence : | |||
| RIIDIDGREKQSAISLHLKQPLHTSSCFLRNTNQSLLHLPILGGIGLQPISDQRQHYLKLRIISRAGVRQLPRLLVLLLRLHALVDQQSGITAVVHDEIGAAARAPIEGPLGAPPVLLQG LTLPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGKGLDEDGSLDGHVETSGDPGTLEGLGGAELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAAGGGLLHLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 24,422.300 | ||
| Theoretical pI: | 5.287 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.759 | ||
| aromaticity | 0.013 | ||
| GRAVY | -0.002 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.288 | ||
| sheet | 0.335 | ||