Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330925.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
RFKTWLAQIPDESTLKMELIDAIQRLGVGYRFVKEIQESLRQIHKTQIRKDDDDDVRVVALHFRLLRQGGYRASCDVFERFIDDEGNFKKSLNNDVEGMLSLYEASYYGVDGEEIMDKAL EFSSSHLESLLHKISTETNNSLSRRLQEALDTPISKASIRLGATKFVFTYQEDESHNEDILNFAKLDFNILQKMHQEETNRVTRWWEDLDFGNKFGFARDRLVES | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 11,124.785 | ||
Theoretical pI: | 9.341 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 38.870 | ||
aromaticity | 0.101 | ||
GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.323 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330925.1 | 5prime_partial | 99 | 675-376(-) |
Amino Acid sequence : | |||
LSTNLSLANPNLFPKSKSSHHLVTRFVSSWCIFCNMLKSNFAKFNISSLCDSSSWYVNTNFVAPNLIEALLIGVSKASCNRLERELLVSVLILWSKDSR* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,124.785 | ||
Theoretical pI: | 9.341 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 38.870 | ||
aromaticity | 0.101 | ||
GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.323 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330925.1 | internal | 225 | 2-676(+) |
Amino Acid sequence : | |||
RFKTWLAQIPDESTLKMELIDAIQRLGVGYRFVKEIQESLRQIHKTQIRKDDDDDVRVVALHFRLLRQGGYRASCDVFERFIDDEGNFKKSLNNDVEGMLSLYEASYYGVDGEEIMDKAL EFSSSHLESLLHKISTETNNSLSRRLQEALDTPISKASIRLGATKFVFTYQEDESHNEDILNFAKLDFNILQKMHQEETNRVTRWWEDLDFGNKFGFARDRLVES | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 11,124.785 | ||
Theoretical pI: | 9.341 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 38.870 | ||
aromaticity | 0.101 | ||
GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.323 | ||
sheet | 0.242 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330925.1 | 5prime_partial | 99 | 675-376(-) |
Amino Acid sequence : | |||
LSTNLSLANPNLFPKSKSSHHLVTRFVSSWCIFCNMLKSNFAKFNISSLCDSSSWYVNTNFVAPNLIEALLIGVSKASCNRLERELLVSVLILWSKDSR* | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,124.785 | ||
Theoretical pI: | 9.341 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18240 | ||
Instability index: | 38.870 | ||
aromaticity | 0.101 | ||
GRAVY | 0.208 | ||
Secondary Structure Fraction | |||
Helix | 0.374 | ||
turn | 0.323 | ||
sheet | 0.242 |