| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330933.1 | internal | 236 | 3-710(+) |
Amino Acid sequence : | |||
| NIWANDLAASLSMLHDLEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDEEFKSWLAFAAQKIVEVNALAKALCGQKDEAFFSANAAAQASRKSSPRVNNEAVKKAAAALRGSDHRRATNV SARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYDKAIKEEINKVVKLQEELDIDVLVHREPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDV | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 26,196.467 | ||
| Theoretical pI: | 7.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 39.127 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.345 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.203 | ||
| sheet | 0.305 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330933.1 | internal | 236 | 3-710(+) |
Amino Acid sequence : | |||
| NIWANDLAASLSMLHDLEGIVGKDKLVVSTSSSLLHTAVDLVNEPKLDEEFKSWLAFAAQKIVEVNALAKALCGQKDEAFFSANAAAQASRKSSPRVNNEAVKKAAAALRGSDHRRATNV SARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKAKKISEEEYDKAIKEEINKVVKLQEELDIDVLVHREPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDV | |||
Physicochemical properties | |||
| Number of amino acids: | 236 | ||
| Molecular weight: | 26,196.467 | ||
| Theoretical pI: | 7.099 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 39.127 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.345 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.203 | ||
| sheet | 0.305 | ||