Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330949.1	5prime_partial	139	3-422(+)
Amino Acid sequence :
TSDGFLSPFEVVSTSACTPKVKRRRSMFADVMVRVIGVSYFTSVPSTVSEPEDSNPSGGVCSCSPARNTTVTPDMLVFPSVSSTGVLFSSTLFKPSTGPSIGPSLMASITLSNCVDFRLS FASRGVCPLLLPLPIPHAP*
Physicochemical properties
Number of amino acids:		139
Molecular weight:		14,305.677
Theoretical pI:		4.770
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		32.867
aromaticity		0.037
GRAVY		-0.438
Secondary Structure Fraction
Helix		0.252
turn		0.311
sheet		0.207

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY330949.1	3prime_partial	135	406-2(-)
Amino Acid sequence :
MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPIEGPVDGLKSVLLNSTPVLDTEGNTNISGVTVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRTITSANIDRLRFTFGVQA LVETTSKGDRNPSEV
Physicochemical properties
Number of amino acids:		135
Molecular weight:		14,305.677
Theoretical pI:		4.770
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		32.867
aromaticity		0.037
GRAVY		-0.438
Secondary Structure Fraction
Helix		0.252
turn		0.311
sheet		0.207