Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330956.1 | 5prime_partial | 190 | 2-574(+) |
Amino Acid sequence : | |||
FEALIERKRMIRRAIEEANIPYTYVSANCFASYFINYLLRPYDPKDEITVYGTGEAKFAMNYEQDIGLYTIKVATDPRALNRVVIYRPSTNIITQLELISRWEKKIGKKFKKIHVPEEEI VALTKELPEPENIPIAILHCLFIDGATMSYDFKENDVEASTLYPELKFTTIDELLDIFVHDPPPPASAAF* | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 21,897.947 | ||
Theoretical pI: | 5.096 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21890 22015 | ||
Instability index: | 50.505 | ||
aromaticity | 0.116 | ||
GRAVY | -0.179 | ||
Secondary Structure Fraction | |||
Helix | 0.353 | ||
turn | 0.179 | ||
sheet | 0.279 |