Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330962.1 | 5prime_partial | 202 | 1-609(+) |
Amino Acid sequence : | |||
VWAKMTPNITDITEPARVSLRTGCEGVAAINTIMSVMGINLDTLRPEPCVEGYSTPGGYSSKAVHPIALAKVMNIAKMMKDEFGDKNYSLSGIGGVETGSDAAEFILLGANTVQVCTGVM MHGYGLVKSLCSELQDFMKKHNFSSIEDFRGASLDYFTTHTDLVRRQREAIQERKAIKKGLQSDKDWTGDGFVKESESMVSN* | |||
Physicochemical properties | |||
Number of amino acids: | 202 | ||
Molecular weight: | 22,039.932 | ||
Theoretical pI: | 5.839 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 39.994 | ||
aromaticity | 0.069 | ||
GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.248 | ||
sheet | 0.248 |