| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330962.1 | 5prime_partial | 202 | 1-609(+) |
Amino Acid sequence : | |||
| VWAKMTPNITDITEPARVSLRTGCEGVAAINTIMSVMGINLDTLRPEPCVEGYSTPGGYSSKAVHPIALAKVMNIAKMMKDEFGDKNYSLSGIGGVETGSDAAEFILLGANTVQVCTGVM MHGYGLVKSLCSELQDFMKKHNFSSIEDFRGASLDYFTTHTDLVRRQREAIQERKAIKKGLQSDKDWTGDGFVKESESMVSN* | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 22,039.932 | ||
| Theoretical pI: | 5.839 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 39.994 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.248 | ||
| sheet | 0.248 | ||