Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330964.1 | 5prime_partial | 234 | 1-705(+) |
Amino Acid sequence : | |||
HLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVH GHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAK* | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 25,695.799 | ||
Theoretical pI: | 5.142 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
Instability index: | 37.165 | ||
aromaticity | 0.038 | ||
GRAVY | -0.406 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.201 | ||
sheet | 0.222 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330964.1 | 5prime_partial | 234 | 1-705(+) |
Amino Acid sequence : | |||
HLRSLSSSNQVDMDTFLFTSESVNEGHPDKLCDQVSDAILDACLEQDPESKVACETCTKTNMVMVFGEITTKAQVNYEKIVRDTCRGIGFTSPDVGLDADNCKVLVNIEQQSPDIAQGVH GHLTKKPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGAKLTEVRKNKTCPWLRPDGKTQVTVEYKNDGGAMVPIRVHTVLISTQHDETVTNDQIAQDLKEHVIKPVIPAK* | |||
Physicochemical properties | |||
Number of amino acids: | 234 | ||
Molecular weight: | 25,695.799 | ||
Theoretical pI: | 5.142 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
Instability index: | 37.165 | ||
aromaticity | 0.038 | ||
GRAVY | -0.406 | ||
Secondary Structure Fraction | |||
Helix | 0.256 | ||
turn | 0.201 | ||
sheet | 0.222 |