| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330969.1 | internal | 174 | 523-2(-) |
Amino Acid sequence : | |||
| ARGTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGD MFESLPKADAVMLMVSFVLPMEILCYTMVLHSLDVGRLKYCGGPGQIGENLVFK | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 18,616.377 | ||
| Theoretical pI: | 8.016 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 18.136 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.153 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.259 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330969.1 | internal | 174 | 523-2(-) |
Amino Acid sequence : | |||
| ARGTRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGD MFESLPKADAVMLMVSFVLPMEILCYTMVLHSLDVGRLKYCGGPGQIGENLVFK | |||
Physicochemical properties | |||
| Number of amino acids: | 174 | ||
| Molecular weight: | 18,616.377 | ||
| Theoretical pI: | 8.016 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 18.136 | ||
| aromaticity | 0.092 | ||
| GRAVY | 0.153 | ||
Secondary Structure Fraction | |||
| Helix | 0.310 | ||
| turn | 0.259 | ||
| sheet | 0.282 | ||