| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330970.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
| TRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFE SLPKADAVMLMVSFVLPMEILCYTMVLHSLDVGRLKYCGGPGQIGENLVFK | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,332.062 | ||
| Theoretical pI: | 6.837 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 19.271 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.174 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.257 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330970.1 | internal | 171 | 2-514(+) |
Amino Acid sequence : | |||
| TRSPAGLSGEALKTGTPLYLKSIRGEDSWNDPAYGFHMRAFTNGMAAHARLTAAAIVTNYPTAFNGVRSVVDVGGRHGMAIGKLVEAFPWVRGIAFDLPEVVADAPPRKGVDFVGGDMFE SLPKADAVMLMVSFVLPMEILCYTMVLHSLDVGRLKYCGGPGQIGENLVFK | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 18,332.062 | ||
| Theoretical pI: | 6.837 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
| Instability index: | 19.271 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.174 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.257 | ||
| sheet | 0.281 | ||