| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330976.1 | 5prime_partial | 153 | 1-462(+) |
Amino Acid sequence : | |||
| LCALRHPFSRSLLSTSLEMASVTAPTVNFSSVSCLVKQNQASNLKKTSLSFSGKAFQSRRLPALRFRVACAAKPETVDKVVDIVRKQLALAEDRVVNGESKFSTLGADSLDTVEIVMGLE EEFGICVEEESAQSISTVQEAADLIETLLEKKC* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 16,611.872 | ||
| Theoretical pI: | 5.531 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
| Instability index: | 51.268 | ||
| aromaticity | 0.046 | ||
| GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.209 | ||
| sheet | 0.320 | ||