Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330976.1 | 5prime_partial | 153 | 1-462(+) |
Amino Acid sequence : | |||
LCALRHPFSRSLLSTSLEMASVTAPTVNFSSVSCLVKQNQASNLKKTSLSFSGKAFQSRRLPALRFRVACAAKPETVDKVVDIVRKQLALAEDRVVNGESKFSTLGADSLDTVEIVMGLE EEFGICVEEESAQSISTVQEAADLIETLLEKKC* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 16,611.872 | ||
Theoretical pI: | 5.531 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
Instability index: | 51.268 | ||
aromaticity | 0.046 | ||
GRAVY | 0.024 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.209 | ||
sheet | 0.320 |