Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330983.1 | 5prime_partial | 160 | 620-138(-) |
Amino Acid sequence : | |||
ITEPDTXKLPYLQAVIKETLRLRMAIPLLVPHMNLHDAKLGGYDIPAESKILVNAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLV QNFELLPPPGQSKIDTTEKGGQFSLHILKHSTIVLKPRSV* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 13,726.682 | ||
Theoretical pI: | 5.662 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 41.584 | ||
aromaticity | 0.049 | ||
GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.189 | ||
sheet | 0.320 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330983.1 | complete | 122 | 171-539(+) |
Amino Acid sequence : | |||
MLQNVKTELATFLRRIDLRLPWWRQQLEVLYESAQRNTQNRQCKDNTRAAPSADAEGEVPKVIAIGLDFSLLLQESLGPELLGLFPLGRVVGKPPRIHQDLALGRDVVATELCIMEVHVG DQ* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,726.682 | ||
Theoretical pI: | 5.662 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 41.584 | ||
aromaticity | 0.049 | ||
GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.189 | ||
sheet | 0.320 |