Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330987.1 | internal | 205 | 3-617(+) |
Amino Acid sequence : | |||
CLFFFLSGFFGASLFSQQESPTSNLRPRTRELVEKKIEFEGLPHGDSGEHSVEAIPFQILSWKPRALYFPKFATAEQCQSIIKMARAQLKPSSLALREGETAEKTKGIRTSSGMFISAYE DKSGTLDQIEKKIAKVTMIPRRHGESFNVLRYEIGQRYQSHYDAFNPAEYGPQKSQRLASFLLYLSDVEEGGETMFPLENGKNID | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 23,216.042 | ||
Theoretical pI: | 7.099 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 44.281 | ||
aromaticity | 0.112 | ||
GRAVY | -0.493 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.249 | ||
sheet | 0.273 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY330987.1 | internal | 205 | 3-617(+) |
Amino Acid sequence : | |||
CLFFFLSGFFGASLFSQQESPTSNLRPRTRELVEKKIEFEGLPHGDSGEHSVEAIPFQILSWKPRALYFPKFATAEQCQSIIKMARAQLKPSSLALREGETAEKTKGIRTSSGMFISAYE DKSGTLDQIEKKIAKVTMIPRRHGESFNVLRYEIGQRYQSHYDAFNPAEYGPQKSQRLASFLLYLSDVEEGGETMFPLENGKNID | |||
Physicochemical properties | |||
Number of amino acids: | 205 | ||
Molecular weight: | 23,216.042 | ||
Theoretical pI: | 7.099 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 44.281 | ||
aromaticity | 0.112 | ||
GRAVY | -0.493 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.249 | ||
sheet | 0.273 |