| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330994.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| NFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT GNTITLE | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 18,916.799 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 32.185 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.223 | ||
| sheet | 0.341 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330994.1 | 5prime_partial | 179 | 743-204(-) |
Amino Acid sequence : | |||
| LQGDGVPRQSLDEYLHASSQPQHQVQGGLLLDVVIGQCTAVLELLAGEDQPLLIRGNTLLVLDLGLDIVDRVGALNLQGDGLPGQSLDEDLHSTAETEDQVEGGFLLNVVISEGAAVFEL LAGEDQPLLVRRDAFLVLDFSLDVVDGVGALHLEGDGLSGEGLHEDLHTTAKTENQVEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 18,916.799 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 32.185 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.223 | ||
| sheet | 0.341 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330994.1 | internal | 247 | 3-743(+) |
Amino Acid sequence : | |||
| NFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT GNTITLE | |||
Physicochemical properties | |||
| Number of amino acids: | 247 | ||
| Molecular weight: | 18,916.799 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 32.185 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.223 | ||
| sheet | 0.341 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY330994.1 | 5prime_partial | 179 | 743-204(-) |
Amino Acid sequence : | |||
| LQGDGVPRQSLDEYLHASSQPQHQVQGGLLLDVVIGQCTAVLELLAGEDQPLLIRGNTLLVLDLGLDIVDRVGALNLQGDGLPGQSLDEDLHSTAETEDQVEGGFLLNVVISEGAAVFEL LAGEDQPLLVRRDAFLVLDFSLDVVDGVGALHLEGDGLSGEGLHEDLHTTAKTENQVEG* | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 18,916.799 | ||
| Theoretical pI: | 4.050 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 32.185 | ||
| aromaticity | 0.028 | ||
| GRAVY | 0.054 | ||
Secondary Structure Fraction | |||
| Helix | 0.346 | ||
| turn | 0.223 | ||
| sheet | 0.341 | ||